PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.009G030900.1
Common NameB456_009G030900, LOC105770100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB_related
Protein Properties Length: 256aa    MW: 27820.4 Da    PI: 10.3456
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.009G030900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.51.5e-13108152347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         +WT+eE+  ++ + ++lG+g+W+ I++ + ++Rt+ q+ s+ qky
  Gorai.009G030900.1 108 PWTEEEHRVFLVGLEKLGKGDWRGISKNFVTTRTPTQVASHAQKY 152
                         8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501588.532318IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129419.486101157IPR017930Myb domain
SuperFamilySSF466895.83E-18103157IPR009057Homeodomain-like
TIGRFAMsTIGR015572.0E-18104156IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.602.3E-11105151IPR009057Homeodomain-like
SMARTSM007172.1E-10105155IPR001005SANT/Myb domain
PfamPF002492.3E-11108152IPR001005SANT/Myb domain
CDDcd001672.00E-9108153No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MGRKCSHCGN IGHNSRTCTT FRGSSVVGGL RLFGVQLGIS SSSSDSLKKS ISMDCLSSSA  60
SPSSPSPSSS LSSPRISMDE LSDKTTSNIG YLSDGLMAPS HERKKGVPWT EEEHRVFLVG  120
LEKLGKGDWR GISKNFVTTR TPTQVASHAQ KYFLRQSTLN KKKRRSSLFD MVRSSSMVAP  180
HVNTSNSQHH HHLMFDKLQY GYIDSQTKTS NATAESMSSN LVPDLELKLA APRPGLEENN  240
KSSPTTLLIR SISVT*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1160164KKKRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX6228272e-49JX622827.1 Gossypium hirsutum clone NBRI_GE69725 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012446609.10.0PREDICTED: transcription factor MYB1R1-like
TrEMBLA0A0D2Q8450.0A0A0D2Q845_G
STRINGVIT_11s0016g02410.t015e-84(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM54962747
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56840.13e-54MYB_related family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]